PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G0594
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 235aa    MW: 27205.2 Da    PI: 5.3683
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G0594genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.6e-181764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l+  vk+lG+ +W+ +a+t g++R++k+c++rw +yl
      Gh_A04G0594 17 KGPWHEEEDERLISFVKLLGSQRWDYVAQTSGLKRSGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding51.52.3e-1672115348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + ++eE+ +++++++++G++ W+ Iar+++ gRt++++k++w+++l
      Gh_A04G0594  72 SISAEEEMIILKLHQKWGNK-WSMIARMLP-GRTDNEIKNYWRTHL 115
                      5699****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7681264IPR017930Myb domain
SuperFamilySSF466893.26E-2814111IPR009057Homeodomain-like
SMARTSM007177.0E-111666IPR001005SANT/Myb domain
PfamPF002492.6E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-211871IPR009057Homeodomain-like
CDDcd001676.04E-81964No hitNo description
PROSITE profilePS5129424.93665119IPR017930Myb domain
SMARTSM007179.0E-1669117IPR001005SANT/Myb domain
PfamPF002493.5E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2472118IPR009057Homeodomain-like
CDDcd001679.25E-1274115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MANETTTAAM QGENLRKGPW HEEEDERLIS FVKLLGSQRW DYVAQTSGLK RSGKSCRLRW  60
VNYLRPNLKH GSISAEEEMI ILKLHQKWGN KWSMIARMLP GRTDNEIKNY WRTHLRKKAV  120
IQDQAWLSTG NFLFIQEDDN SPNSKTYNGE SYNPFVDISD TQNSCYAAAP VSDFGTSPYE  180
TRLSDWIPEF QSDQSEIKSQ LDSTTTTTHS CNFYPALFYE ENDVWGYSGS LWNMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-28151192105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-27141193159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-27141193159MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-28151192105C-Myb DNA-Binding Domain
1msf_C7e-28151192105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6160101e-160JX616010.1 Gossypium hirsutum clone NBRI_GE60350 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443026.11e-157PREDICTED: myb-related protein 305 isoform X3
TrEMBLA0A0D2TZX61e-156A0A0D2TZX6_G
STRINGGLYMA13G20880.22e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.11e-64myb domain protein 27